MOTS-C
MOTS-C Price range: $60.00 through $175.00
Back to products
LL37
LL37 Original price was: $110.00.Current price is: $90.00.

FOXO4

Original price was: $320.00.Current price is: $280.00.

FOXO4-DRI, an anti-aging peptide, selectively eliminates senescent cells by blocking the interaction between FOXO4 and p53. Its mechanisms of action include inducing apoptosis of senescent cells, improving tissue microenvironment, and delaying the aging process, demonstrating potential applications in anti-aging, treatment of testicular hypofunction, radiation-induced pulmonary fibrosis, neurodegenerative diseases, cardiovascular disease prevention, and other fields. By regulating signaling pathways and clearing senescent cells, it restores tissue function and provides new strategies for the treatment of multiple diseases.

The peptide will be provided as lyophilized powder to ensure maximum stability.
SKU: N/A Category:
Description

▎What is FOXO4-DRI?

The full name of FOXO4-DRI is FOXO4 D-Retro-Inverso. It is an anti-aging polypeptide that selectively induces the apoptosis of senescent cells by blocking the interaction between FOXO4 and p53, thereby improving the tissue microenvironment and delaying the aging process.

▎FOXO4-DRI Structure

Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

Molecular Formula: C228H388N86O64

Molecular Weight: 5358g/mol

PubChem CID: 168431240

Synonyms: EX-A7431

Additional information
Specification

10 mg/vial,10 vial/kits

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “FOXO4”

Your email address will not be published. Required fields are marked *

Shipping & Delivery

MAECENAS IACULIS

Vestibulum curae torquent diam diam commodo parturient penatibus nunc dui adipiscing convallis bulum parturient suspendisse parturient a.Parturient in parturient scelerisque nibh lectus quam a natoque adipiscing a vestibulum hendrerit et pharetra fames nunc natoque dui.

ADIPISCING CONVALLIS BULUM

  • Vestibulum penatibus nunc dui adipiscing convallis bulum parturient suspendisse.
  • Abitur parturient praesent lectus quam a natoque adipiscing a vestibulum hendre.
  • Diam parturient dictumst parturient scelerisque nibh lectus.

Scelerisque adipiscing bibendum sem vestibulum et in a a a purus lectus faucibus lobortis tincidunt purus lectus nisl class eros.Condimentum a et ullamcorper dictumst mus et tristique elementum nam inceptos hac parturient scelerisque vestibulum amet elit ut volutpat.